CCNJL monoclonal antibody (M01), clone 4E10
  • CCNJL monoclonal antibody (M01), clone 4E10

CCNJL monoclonal antibody (M01), clone 4E10

Ref: AB-H00079616-M01
CCNJL monoclonal antibody (M01), clone 4E10

Información del producto

CCNJL monoclonal antibody (M01), clone 4E10
Información adicional
Size 100 ug
Gene Name CCNJL
Gene Alias FLJ14166
Gene Description cyclin J-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPLDMCPVPVPASLSMHMAIAAEPRHCLATTYGSSYFSGSHMFPTGCFDR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCNJL (AAH13353.1, 1 a.a. ~ 121 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79616
Clone Number 4E10
Iso type IgG1 Kappa

Enviar un mensaje


CCNJL monoclonal antibody (M01), clone 4E10

CCNJL monoclonal antibody (M01), clone 4E10