LASS4 monoclonal antibody (M05), clone 2C12
  • LASS4 monoclonal antibody (M05), clone 2C12

LASS4 monoclonal antibody (M05), clone 2C12

Ref: AB-H00079603-M05
LASS4 monoclonal antibody (M05), clone 2C12

Información del producto

LASS4 monoclonal antibody (M05), clone 2C12
Información adicional
Size 100 ug
Gene Name LASS4
Gene Alias CerS4|FLJ12089|Trh1
Gene Description LAG1 homolog, ceramide synthase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq ERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LASS4 (NP_078828, 57 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79603
Clone Number 2C12
Iso type IgG2a Kappa

Enviar un mensaje


LASS4 monoclonal antibody (M05), clone 2C12

LASS4 monoclonal antibody (M05), clone 2C12