ADIPOR2 DNAxPab
  • ADIPOR2 DNAxPab

ADIPOR2 DNAxPab

Ref: AB-H00079602-W01P
ADIPOR2 DNAxPab

Información del producto

Rabbit polyclonal antibody raised against a partial-length human ADIPOR2 DNA using DNAx™ Immune technology.
Información adicional
Size 100 ug
Gene Name ADIPOR2
Gene Alias ACDCR2|FLJ21432|MGC4640|PAQR2
Gene Description adiponectin receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IF-Tr,Flow Cyt-Tr
Immunogen Prot. Seq MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ADIPOR2 (NP_078827.2, 169 a.a. ~ 386 a.a) partial-length human DNA
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79602

Enviar un mensaje


ADIPOR2 DNAxPab

ADIPOR2 DNAxPab