C2orf47 purified MaxPab rabbit polyclonal antibody (D01P)
  • C2orf47 purified MaxPab rabbit polyclonal antibody (D01P)

C2orf47 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00079568-D01P
C2orf47 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

C2orf47 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name C2orf47
Gene Alias DKFZp666A212|FLJ22555
Gene Description chromosome 2 open reading frame 47
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MALAARLQPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARALAASALPAQGSRWPVLSSPGLPAAFTSFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKSALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETLRGASVFQVKLGNQNV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C2orf47 (AAH17959.1, 1 a.a. ~ 291 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79568

Enviar un mensaje


C2orf47 purified MaxPab rabbit polyclonal antibody (D01P)

C2orf47 purified MaxPab rabbit polyclonal antibody (D01P)