LRRC2 monoclonal antibody (M02), clone 1G3
  • LRRC2 monoclonal antibody (M02), clone 1G3

LRRC2 monoclonal antibody (M02), clone 1G3

Ref: AB-H00079442-M02
LRRC2 monoclonal antibody (M02), clone 1G3

Información del producto

LRRC2 monoclonal antibody (M02), clone 1G3
Información adicional
Size 100 ug
Gene Name LRRC2
Gene Alias -
Gene Description leucine rich repeat containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LTYLPYSMLNLKKLTLLVVSGDHLVELPTALCDSSTPLKFVSLMDNPIDNAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LRRC2 (NP_078788, 272 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79442
Clone Number 1G3
Iso type IgG1 Kappa

Enviar un mensaje


LRRC2 monoclonal antibody (M02), clone 1G3

LRRC2 monoclonal antibody (M02), clone 1G3