KREMEN2 polyclonal antibody (A01)
  • KREMEN2 polyclonal antibody (A01)

KREMEN2 polyclonal antibody (A01)

Ref: AB-H00079412-A01
KREMEN2 polyclonal antibody (A01)

Información del producto

KREMEN2 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name KREMEN2
Gene Alias KRM2|MGC10791|MGC16709
Gene Description kringle containing transmembrane protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KREMEN2 (NP_078783, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 79412

Enviar un mensaje


KREMEN2 polyclonal antibody (A01)

KREMEN2 polyclonal antibody (A01)