IRX1 polyclonal antibody (A01)
  • IRX1 polyclonal antibody (A01)

IRX1 polyclonal antibody (A01)

Ref: AB-H00079192-A01
IRX1 polyclonal antibody (A01)

Información del producto

IRX1 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name IRX1
Gene Alias IRX-5|IRXA1
Gene Description iroquois homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IRX1 (NP_077313, 424 a.a. ~ 479 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 79192

Enviar un mensaje


IRX1 polyclonal antibody (A01)

IRX1 polyclonal antibody (A01)