IRX6 monoclonal antibody (M01), clone 1A5
  • IRX6 monoclonal antibody (M01), clone 1A5

IRX6 monoclonal antibody (M01), clone 1A5

Ref: AB-H00079190-M01
IRX6 monoclonal antibody (M01), clone 1A5

Información del producto

IRX6 monoclonal antibody (M01), clone 1A5
Información adicional
Size 100 ug
Gene Name IRX6
Gene Alias IRX-3|IRX7|IRXB3
Gene Description iroquois homeobox 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq PRLTMHYPCLEKPRIWSLAHTATASAVEGAPPARPRPRSPECRMIPGQPPASARRLSVPRDSACDESSCIPKAFGNPKFALQGLPLNCAPCPRRSEPVVQCQYPSGAEAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IRX6 (NP_077311, 337 a.a. ~ 446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79190
Clone Number 1A5
Iso type IgG1 Kappa

Enviar un mensaje


IRX6 monoclonal antibody (M01), clone 1A5

IRX6 monoclonal antibody (M01), clone 1A5