BRCC3 purified MaxPab mouse polyclonal antibody (B01P)
  • BRCC3 purified MaxPab mouse polyclonal antibody (B01P)

BRCC3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079184-B01P
BRCC3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BRCC3 protein.
Información adicional
Size 50 ug
Gene Name BRCC3
Gene Alias BRCC36|C6.1A|CXorf53
Gene Description BRCA1/BRCA2-containing complex, subunit 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BRCC3 (NP_077308.1, 1 a.a. ~ 316 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79184

Enviar un mensaje


BRCC3 purified MaxPab mouse polyclonal antibody (B01P)

BRCC3 purified MaxPab mouse polyclonal antibody (B01P)