CRELD2 monoclonal antibody (M03A), clone 2B6
  • CRELD2 monoclonal antibody (M03A), clone 2B6

CRELD2 monoclonal antibody (M03A), clone 2B6

Ref: AB-H00079174-M03A
CRELD2 monoclonal antibody (M03A), clone 2B6

Información del producto

CRELD2 monoclonal antibody (M03A), clone 2B6
Información adicional
Size 200 uL
Gene Name CRELD2
Gene Alias DKFZp667O055|MGC11256
Gene Description cysteine-rich with EGF-like domains 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRELD2 (NP_077300, 162 a.a. ~ 258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 79174
Clone Number 2B6
Iso type IgM Kappa

Enviar un mensaje


CRELD2 monoclonal antibody (M03A), clone 2B6

CRELD2 monoclonal antibody (M03A), clone 2B6