CRELD2 purified MaxPab mouse polyclonal antibody (B01P)
  • CRELD2 purified MaxPab mouse polyclonal antibody (B01P)

CRELD2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079174-B01P
CRELD2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

CRELD2 purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name CRELD2
Gene Alias DKFZp667O055|MGC11256
Gene Description cysteine-rich with EGF-like domains 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYESSEIRLLEILEGLCESSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CRELD2 (AAH02894.1, 1 a.a. ~ 321 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79174

Enviar un mensaje


CRELD2 purified MaxPab mouse polyclonal antibody (B01P)

CRELD2 purified MaxPab mouse polyclonal antibody (B01P)