ZSCAN5A purified MaxPab mouse polyclonal antibody (B01P)
  • ZSCAN5A purified MaxPab mouse polyclonal antibody (B01P)

ZSCAN5A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079149-B01P
ZSCAN5A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZSCAN5A protein.
Información adicional
Size 50 ug
Gene Name ZSCAN5A
Gene Alias MGC4161|ZNF495|ZSCAN5
Gene Description zinc finger and SCAN domain containing 5A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAANCTSSWSLGESCNRPGLELPRSMASSETQLGNHDVDPEISHVNFRMFSCPKESDPIQALRKLTELCHLWLRPDLHTKEQILDMLVMEQFMISMPQELQVLVMMNGVQSCKDLEDLLRNNRRPKKWSVVTFHGKEYIVQDSDIEMAEAPSSVRDDLKDVSSQRASSVNQMRPGEGQAHRELQILPRVPALSRRQGEDFLLHKSIDVTGDPKSLRPKQTLEKDLKENREENPGLTSPEPQLPKSPTDLVRAKEG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZSCAN5A (AAH43232.1, 1 a.a. ~ 496 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79149

Enviar un mensaje


ZSCAN5A purified MaxPab mouse polyclonal antibody (B01P)

ZSCAN5A purified MaxPab mouse polyclonal antibody (B01P)