MMP28 polyclonal antibody (A01)
  • MMP28 polyclonal antibody (A01)

MMP28 polyclonal antibody (A01)

Ref: AB-H00079148-A01
MMP28 polyclonal antibody (A01)

Información del producto

MMP28 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name MMP28
Gene Alias EPILYSIN|MM28|MMP-28|MMP25
Gene Description matrix metallopeptidase 28
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MMP28 (NP_077278, 441 a.a. ~ 520 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 79148

Enviar un mensaje


MMP28 polyclonal antibody (A01)

MMP28 polyclonal antibody (A01)