LENG4 monoclonal antibody (M02), clone 1D4
  • LENG4 monoclonal antibody (M02), clone 1D4

LENG4 monoclonal antibody (M02), clone 1D4

Ref: AB-H00079143-M02
LENG4 monoclonal antibody (M02), clone 1D4

Información del producto

LENG4 monoclonal antibody (M02), clone 1D4
Información adicional
Size 100 ug
Gene Name MBOAT7
Gene Alias BB1|LENG4|LPIAT|hMBOA-7
Gene Description membrane bound O-acyltransferase domain containing 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq TPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEMASGFSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LENG4 (NP_077274.2, 96 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79143
Clone Number 1D4
Iso type IgG2a Kappa

Enviar un mensaje


LENG4 monoclonal antibody (M02), clone 1D4

LENG4 monoclonal antibody (M02), clone 1D4