DHX58 purified MaxPab rabbit polyclonal antibody (D01P)
  • DHX58 purified MaxPab rabbit polyclonal antibody (D01P)

DHX58 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00079132-D01P
DHX58 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

DHX58 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name DHX58
Gene Alias D11LGP2|D11lgp2e|LGP2
Gene Description DEXH (Asp-Glu-X-His) box polypeptide 58
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDTVYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DHX58 (AAH14949.1, 1 a.a. ~ 678 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79132

Enviar un mensaje


DHX58 purified MaxPab rabbit polyclonal antibody (D01P)

DHX58 purified MaxPab rabbit polyclonal antibody (D01P)