CARD14 monoclonal antibody (M01), clone 4B3
  • CARD14 monoclonal antibody (M01), clone 4B3

CARD14 monoclonal antibody (M01), clone 4B3

Ref: AB-H00079092-M01
CARD14 monoclonal antibody (M01), clone 4B3

Información del producto

CARD14 monoclonal antibody (M01), clone 4B3
Información adicional
Size 100 ug
Gene Name CARD14
Gene Alias BIMP2|CARMA2
Gene Description caspase recruitment domain family, member 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq VQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTSEEQLLEAARQEEGDLDRAPCLYSSLAPDGWSDLDGLLSCVRQAIADEQKKVVWTEQSPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CARD14 (NP_077015, 905 a.a. ~ 1004 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79092
Clone Number 4B3
Iso type IgG2b Kappa

Enviar un mensaje


CARD14 monoclonal antibody (M01), clone 4B3

CARD14 monoclonal antibody (M01), clone 4B3