SLC25A23 monoclonal antibody (M04), clone 3E1
  • SLC25A23 monoclonal antibody (M04), clone 3E1

SLC25A23 monoclonal antibody (M04), clone 3E1

Ref: AB-H00079085-M04
SLC25A23 monoclonal antibody (M04), clone 3E1

Información del producto

SLC25A23 monoclonal antibody (M04), clone 3E1
Información adicional
Size 100 ug
Gene Name SLC25A23
Gene Alias APC2|MCSC2|MGC2615|SCaMC-3
Gene Description solute carrier family 25 (mitochondrial carrier
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC25A23 (NP_077008.2, 2 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79085
Clone Number 3E1
Iso type IgG2a Kappa

Enviar un mensaje


SLC25A23 monoclonal antibody (M04), clone 3E1

SLC25A23 monoclonal antibody (M04), clone 3E1