XTP3TPA purified MaxPab mouse polyclonal antibody (B01P)
  • XTP3TPA purified MaxPab mouse polyclonal antibody (B01P)

XTP3TPA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079077-B01P
XTP3TPA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human XTP3TPA protein.
Información adicional
Size 50 ug
Gene Name DCTPP1
Gene Alias CDA03|MGC5627|RS21C6|XTP3TPA
Gene Description dCTP pyrophosphatase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen XTP3TPA (NP_077001.1, 1 a.a. ~ 170 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79077

Enviar un mensaje


XTP3TPA purified MaxPab mouse polyclonal antibody (B01P)

XTP3TPA purified MaxPab mouse polyclonal antibody (B01P)