ALG8 monoclonal antibody (M01), clone 2E10
  • ALG8 monoclonal antibody (M01), clone 2E10

ALG8 monoclonal antibody (M01), clone 2E10

Ref: AB-H00079053-M01
ALG8 monoclonal antibody (M01), clone 2E10

Información del producto

ALG8 monoclonal antibody (M01), clone 2E10
Información adicional
Size 100 ug
Gene Name ALG8
Gene Alias MGC2840
Gene Description asparagine-linked glycosylation 8, alpha-1,3-glucosyltransferase homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NQLPQVFSRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIGLKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALG8 (NP_076984, 260 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79053
Clone Number 2E10
Iso type IgG2a Kappa

Enviar un mensaje


ALG8 monoclonal antibody (M01), clone 2E10

ALG8 monoclonal antibody (M01), clone 2E10