DDX54 monoclonal antibody (M03), clone 5B3
  • DDX54 monoclonal antibody (M03), clone 5B3

DDX54 monoclonal antibody (M03), clone 5B3

Ref: AB-H00079039-M03
DDX54 monoclonal antibody (M03), clone 5B3

Información del producto

DDX54 monoclonal antibody (M03), clone 5B3
Información adicional
Size 100 ug
Gene Name DDX54
Gene Alias DP97|MGC2835
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX54 (NP_076977, 778 a.a. ~ 881 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79039
Clone Number 5B3
Iso type IgG2a Kappa

Enviar un mensaje


DDX54 monoclonal antibody (M03), clone 5B3

DDX54 monoclonal antibody (M03), clone 5B3