DDX54 monoclonal antibody (M02), clone 2E4
  • DDX54 monoclonal antibody (M02), clone 2E4

DDX54 monoclonal antibody (M02), clone 2E4

Ref: AB-H00079039-M02
DDX54 monoclonal antibody (M02), clone 2E4

Información del producto

DDX54 monoclonal antibody (M02), clone 2E4
Información adicional
Size 50 ug
Gene Name DDX54
Gene Alias DP97|MGC2835
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,ELISA
Immunogen Prot. Seq DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX54 (NP_076977, 778 a.a. ~ 881 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79039
Clone Number 2E4
Iso type IgG1 Kappa

Enviar un mensaje


DDX54 monoclonal antibody (M02), clone 2E4

DDX54 monoclonal antibody (M02), clone 2E4