DDX54 MaxPab rabbit polyclonal antibody (D01)
  • DDX54 MaxPab rabbit polyclonal antibody (D01)

DDX54 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00079039-D01
DDX54 MaxPab rabbit polyclonal antibody (D01)

Información del producto

DDX54 MaxPab rabbit polyclonal antibody (D01)
Información adicional
Size 100 uL
Gene Name DDX54
Gene Alias DP97|MGC2835
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MAADKGPAAGPRSRAAMAQWRKKKGLRKRRGAASQARGSDSEDGEFEIQAEDDARARKLGPGRPLPTFPTSECTSDVEPDTREMVRAQNKKKKKSGGFQSMGLSYPVFKGIMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTACFLLPMFERLKTHSAQTGARALILSPTRELALQTLKFTKELGKFTGLKTALILGGDRMEDQFAALHENPDIIIATPGRLVHVAVEMSLKLQSVEYVVFDEADRLFEM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DDX54 (NP_076977.3, 1 a.a. ~ 881 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 79039

Enviar un mensaje


DDX54 MaxPab rabbit polyclonal antibody (D01)

DDX54 MaxPab rabbit polyclonal antibody (D01)