DDX54 polyclonal antibody (A01)
  • DDX54 polyclonal antibody (A01)

DDX54 polyclonal antibody (A01)

Ref: AB-H00079039-A01
DDX54 polyclonal antibody (A01)

Información del producto

DDX54 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name DDX54
Gene Alias DP97|MGC2835
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX54 (NP_076977, 778 a.a. ~ 881 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 79039

Enviar un mensaje


DDX54 polyclonal antibody (A01)

DDX54 polyclonal antibody (A01)