C19orf50 purified MaxPab mouse polyclonal antibody (B01P)
  • C19orf50 purified MaxPab mouse polyclonal antibody (B01P)

C19orf50 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079036-B01P
C19orf50 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C19orf50 protein.
Información adicional
Size 50 ug
Gene Name C19orf50
Gene Alias FLJ25480|MGC2749|MST096|MSTP096
Gene Description chromosome 19 open reading frame 50
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C19orf50 (NP_076974.1, 1 a.a. ~ 176 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79036

Enviar un mensaje


C19orf50 purified MaxPab mouse polyclonal antibody (B01P)

C19orf50 purified MaxPab mouse polyclonal antibody (B01P)