SPATA5L1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SPATA5L1 purified MaxPab rabbit polyclonal antibody (D01P)

SPATA5L1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00079029-D01P
SPATA5L1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

SPATA5L1 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name SPATA5L1
Gene Alias FLJ12286|MGC5347
Gene Description spermatogenesis associated 5-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPDSDPFPEGPLLKLLPLDARDRGTQRCRLGPAALHALGARLGSAVKISLPDGGSCLCTAWPRRDGADGFVQLDPLCASPGAAVGASRSRRSLSLNRLLLVPCPPLRRVAVWPVLRERAGAPGARNTAAVLEAAQELLRNRPISLGHVVVAPPGAPGLVAALHIVGGTPSPDPAGLVTPRTRVSLGGEPPSEAQPQPEVPLGGLSEAADSLRELLRLPLRYPRALTALGLAVPRGVLLAGPPGVGKTQLVQAVA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPATA5L1 (AAH51861.1, 1 a.a. ~ 426 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79029

Enviar un mensaje


SPATA5L1 purified MaxPab rabbit polyclonal antibody (D01P)

SPATA5L1 purified MaxPab rabbit polyclonal antibody (D01P)