AHNAK purified MaxPab mouse polyclonal antibody (B01P)
  • AHNAK purified MaxPab mouse polyclonal antibody (B01P)

AHNAK purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079026-B01P
AHNAK purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

AHNAK purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name AHNAK
Gene Alias AHNAKRS|MGC5395
Gene Description AHNAK nucleoprotein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVVLNTPQPSALECKDQNKQKEASSQAGAVSVSTPNAGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AHNAK (NP_076965.2, 1 a.a. ~ 149 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79026

Enviar un mensaje


AHNAK purified MaxPab mouse polyclonal antibody (B01P)

AHNAK purified MaxPab mouse polyclonal antibody (B01P)