AHNAK MaxPab mouse polyclonal antibody (B01)
  • AHNAK MaxPab mouse polyclonal antibody (B01)

AHNAK MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00079026-B01
AHNAK MaxPab mouse polyclonal antibody (B01)

Información del producto

AHNAK MaxPab mouse polyclonal antibody (B01)
Información adicional
Size 50 uL
Gene Name AHNAK
Gene Alias AHNAKRS|MGC5395
Gene Description AHNAK nucleoprotein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVVLNTPQPSALECKDQNKQKEASSQAGAVSVSTPNAGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AHNAK (NP_076965, 1 a.a. ~ 149 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 79026

Enviar un mensaje


AHNAK MaxPab mouse polyclonal antibody (B01)

AHNAK MaxPab mouse polyclonal antibody (B01)