DDX50 purified MaxPab rabbit polyclonal antibody (D01P)
  • DDX50 purified MaxPab rabbit polyclonal antibody (D01P)

DDX50 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00079009-D01P
DDX50 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

DDX50 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name DDX50
Gene Alias GU2|GUB|MGC3199|RH-II/GuB
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSVACFYGGTSYQSQINH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DDX50 (NP_076950.1, 1 a.a. ~ 737 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79009

Enviar un mensaje


DDX50 purified MaxPab rabbit polyclonal antibody (D01P)

DDX50 purified MaxPab rabbit polyclonal antibody (D01P)