DBNDD1 monoclonal antibody (M02), clone 4G4
  • DBNDD1 monoclonal antibody (M02), clone 4G4

DBNDD1 monoclonal antibody (M02), clone 4G4

Ref: AB-H00079007-M02
DBNDD1 monoclonal antibody (M02), clone 4G4

Información del producto

DBNDD1 monoclonal antibody (M02), clone 4G4
Información adicional
Size 100 ug
Gene Name DBNDD1
Gene Alias FLJ12582|MGC3101
Gene Description dysbindin (dystrobrevin binding protein 1) domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAGLPIPPEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DBNDD1 (ENSP00000306407, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79007
Clone Number 4G4
Iso type IgG2b Kappa

Enviar un mensaje


DBNDD1 monoclonal antibody (M02), clone 4G4

DBNDD1 monoclonal antibody (M02), clone 4G4