CRELD1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CRELD1 purified MaxPab rabbit polyclonal antibody (D01P)

CRELD1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00078987-D01P
CRELD1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

CRELD1 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name CRELD1
Gene Alias AVSD2|CIRRIN|DKFZp566D213
Gene Description cysteine-rich with EGF-like domains 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPWPPKGLVPAVLWGLSLFLNLPGPIWLQPSPPPQSSPPPQPHPCHTCRGLVDSFNKGLERTIRDNFGGGNTAWEEENLSKYKDSETRLVEVLEGVCSKSDFECHRLLELSEELVESWWFHKQQEAPDLFQWLCSDSLKLCCPAGTFGPSCLPCPGGTERPCGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGAN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CRELD1 (NP_001026887.1, 1 a.a. ~ 422 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 78987

Enviar un mensaje


CRELD1 purified MaxPab rabbit polyclonal antibody (D01P)

CRELD1 purified MaxPab rabbit polyclonal antibody (D01P)