BOLL monoclonal antibody (M13), clone 1C3
  • BOLL monoclonal antibody (M13), clone 1C3

BOLL monoclonal antibody (M13), clone 1C3

Ref: AB-H00066037-M13
BOLL monoclonal antibody (M13), clone 1C3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant BOLL.
Información adicional
Size 100 ug
Gene Name BOLL
Gene Alias -
Gene Description bol, boule-like (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BOLL (NP_149019, 80 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 66037
Clone Number 1C3
Iso type IgG2a Kappa

Enviar un mensaje


BOLL monoclonal antibody (M13), clone 1C3

BOLL monoclonal antibody (M13), clone 1C3