DLK2 purified MaxPab mouse polyclonal antibody (B01P)
  • DLK2 purified MaxPab mouse polyclonal antibody (B01P)

DLK2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00065989-B01P
DLK2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

DLK2 purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name DLK2
Gene Alias EGFL9|MGC111055|MGC2487
Gene Description delta-like 2 homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DLK2 (NP_076421.2, 1 a.a. ~ 383 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65989

Enviar un mensaje


DLK2 purified MaxPab mouse polyclonal antibody (B01P)

DLK2 purified MaxPab mouse polyclonal antibody (B01P)