ZNF747 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF747 purified MaxPab mouse polyclonal antibody (B01P)

ZNF747 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00065988-B01P
ZNF747 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF747 protein.
Información adicional
Size 50 ug
Gene Name ZNF747
Gene Alias MGC2474
Gene Description zinc finger protein 747
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTDPSLGLTVPMAPPLAPLPPRDPNGAGSEWRKPGAVSFADVAVYFSREEWGCLRPAQRALYRDVMRETYGHLGALGESPTCLPGPCASTGPAAPLGAACGVGGPGAGQAASSQRGVCVLLPQESEAASRRSSPGWRRRPNCGIRLPRIRRWRSVRQKRTQQIPETRKRKDKGKGREPWRSPTLWPPGLLG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF747 (NP_076420.1, 1 a.a. ~ 191 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65988

Enviar un mensaje


ZNF747 purified MaxPab mouse polyclonal antibody (B01P)

ZNF747 purified MaxPab mouse polyclonal antibody (B01P)