AACS purified MaxPab rabbit polyclonal antibody (D01P)
  • AACS purified MaxPab rabbit polyclonal antibody (D01P)

AACS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00065985-D01P
AACS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

AACS purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name AACS
Gene Alias ACSF1|FLJ12389|FLJ41251|SUR-5
Gene Description acetoacetyl-CoA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MVCWTGFLKFSQKLIFSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVIPYVSSRENIDLSKIPNSVFLDDFLATGTSEQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCMVHSAGGTLIQHLKEHLLHGNMTSSDILLCYTTVGWMMWNWMVSLLATGAAMVLYDGSPLVPTPNVLWDLVDRIGITVLVTGAKWLSVLEEEAMKPVETHSLQMLHTILSTGSPLKAQSYEYVYRCIKSSILLGSISGGTDIISC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AACS (AAH41000.1, 1 a.a. ~ 410 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65985

Enviar un mensaje


AACS purified MaxPab rabbit polyclonal antibody (D01P)

AACS purified MaxPab rabbit polyclonal antibody (D01P)