UBE2Z purified MaxPab mouse polyclonal antibody (B01P)
  • UBE2Z purified MaxPab mouse polyclonal antibody (B01P)

UBE2Z purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00065264-B01P
UBE2Z purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UBE2Z protein.
Información adicional
Size 50 ug
Gene Name UBE2Z
Gene Alias FLJ13855|HOYS7|USE1
Gene Description ubiquitin-conjugating enzyme E2Z
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBE2Z (NP_075567.1, 1 a.a. ~ 246 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65264

Enviar un mensaje


UBE2Z purified MaxPab mouse polyclonal antibody (B01P)

UBE2Z purified MaxPab mouse polyclonal antibody (B01P)