PYCRL MaxPab rabbit polyclonal antibody (D01)
  • PYCRL MaxPab rabbit polyclonal antibody (D01)

PYCRL MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00065263-D01
PYCRL MaxPab rabbit polyclonal antibody (D01)

Información del producto

PYCRL MaxPab rabbit polyclonal antibody (D01)
Información adicional
Size 100 uL
Gene Name PYCRL
Gene Alias FLJ13852
Gene Description pyrroline-5-carboxylate reductase-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMARGRHVGSSETNLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PYCRL (AAH07993.1, 1 a.a. ~ 274 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 65263

Enviar un mensaje


PYCRL MaxPab rabbit polyclonal antibody (D01)

PYCRL MaxPab rabbit polyclonal antibody (D01)