PYCRL polyclonal antibody (A01)
  • PYCRL polyclonal antibody (A01)

PYCRL polyclonal antibody (A01)

Ref: AB-H00065263-A01
PYCRL polyclonal antibody (A01)

Información del producto

PYCRL polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name PYCRL
Gene Alias FLJ13852
Gene Description pyrroline-5-carboxylate reductase-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PYCRL (NP_075566, 32 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 65263

Enviar un mensaje


PYCRL polyclonal antibody (A01)

PYCRL polyclonal antibody (A01)