MPPE1 purified MaxPab rabbit polyclonal antibody (D01P)
  • MPPE1 purified MaxPab rabbit polyclonal antibody (D01P)

MPPE1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00065258-D01P
MPPE1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

MPPE1 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name MPPE1
Gene Alias -
Gene Description metallophosphoesterase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAMIELGFGRQNFHPLKRKSSLLLKLIAVVFAVLLFCEFLIYYLAIFQCNWPEVKTTASDGEQTTREPVLKAMFLADTHLLGEFLGHWLDKLRREWQMERAFQTALWLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAGNHDIGFHYEMNTYKVERFEKVFSSERLFSWKGINFVMVNSVALNGDGCGICSETEAELIEVSHRLNCSREQARGSSRCGPGPLLPTSAPVLLQHYPLYR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MPPE1 (AAH73994.1, 1 a.a. ~ 341 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65258

Enviar un mensaje


MPPE1 purified MaxPab rabbit polyclonal antibody (D01P)

MPPE1 purified MaxPab rabbit polyclonal antibody (D01P)