NOL6 purified MaxPab mouse polyclonal antibody (B02P)
  • NOL6 purified MaxPab mouse polyclonal antibody (B02P)

NOL6 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00065083-B02P
NOL6 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

NOL6 purified MaxPab mouse polyclonal antibody (B02P)
Información adicional
Size 50 ug
Gene Name NOL6
Gene Alias FLJ21959|MGC14896|MGC14921|MGC20838|NRAP|UTP22|bA311H10.1
Gene Description nucleolar protein family 6 (RNA-associated)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGPAPAGEQLRGATGEPEVMEPALEGTGKEGKKASSRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLRLQVEELLKEVRLSEKKKDRIDAFLREVNQRVVRVPSVPETELTDQAWLPAGVRVPLHQVPYAVKGCFRFLPPAQVTVVGSYLLGTCIRPDINVDVALTMPREILQDKDGLNQRYFRKRALYLAHLAHHLAQDPLFGSVCFSYTNGCHLKPSLLLRPRGKDERLVTVRLHP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOL6 (AAH30139.1, 1 a.a. ~ 1143 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65083

Enviar un mensaje


NOL6 purified MaxPab mouse polyclonal antibody (B02P)

NOL6 purified MaxPab mouse polyclonal antibody (B02P)