RTN4R MaxPab rabbit polyclonal antibody (D01)
  • RTN4R MaxPab rabbit polyclonal antibody (D01)

RTN4R MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00065078-D01
RTN4R MaxPab rabbit polyclonal antibody (D01)

Información del producto

RTN4R MaxPab rabbit polyclonal antibody (D01)
Información adicional
Size 100 uL
Gene Name RTN4R
Gene Alias NGR|NOGOR
Gene Description reticulon 4 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MKRASAGGSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RTN4R (NP_075380.1, 1 a.a. ~ 473 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 65078

Enviar un mensaje


RTN4R MaxPab rabbit polyclonal antibody (D01)

RTN4R MaxPab rabbit polyclonal antibody (D01)