PINK1 polyclonal antibody (A01)
  • PINK1 polyclonal antibody (A01)

PINK1 polyclonal antibody (A01)

Ref: AB-H00065018-A01
PINK1 polyclonal antibody (A01)

Información del producto

PINK1 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name PINK1
Gene Alias BRPK|FLJ27236|PARK6
Gene Description PTEN induced putative kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAAGAPAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PINK1 (AAH28215, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 65018

Enviar un mensaje


PINK1 polyclonal antibody (A01)

PINK1 polyclonal antibody (A01)