SLC26A6 polyclonal antibody (A01)
  • SLC26A6 polyclonal antibody (A01)

SLC26A6 polyclonal antibody (A01)

Ref: AB-H00065010-A01
SLC26A6 polyclonal antibody (A01)

Información del producto

SLC26A6 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name SLC26A6
Gene Alias DKFZp586E1422
Gene Description solute carrier family 26, member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGHFFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC26A6 (NP_075062, 666 a.a. ~ 738 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 65010

Enviar un mensaje


SLC26A6 polyclonal antibody (A01)

SLC26A6 polyclonal antibody (A01)