PCDH20 monoclonal antibody (M01), clone 2C3
  • PCDH20 monoclonal antibody (M01), clone 2C3

PCDH20 monoclonal antibody (M01), clone 2C3

Ref: AB-H00064881-M01
PCDH20 monoclonal antibody (M01), clone 2C3

Información del producto

PCDH20 monoclonal antibody (M01), clone 2C3
Información adicional
Size 100 ug
Gene Name PCDH20
Gene Alias FLJ22218|PCDH13
Gene Description protocadherin 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RPPEIVPRYIANEIDGVVYLKELEPVNTPIAFFTIRDPEGKYKVNCYLDGEGPFRLSPYKPYNNEYLLETTKPMDYELQQFYEVAVVAWNSEGFHVKRVI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDH20 (NP_073754, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64881
Clone Number 2C3
Iso type IgG2a Kappa

Enviar un mensaje


PCDH20 monoclonal antibody (M01), clone 2C3

PCDH20 monoclonal antibody (M01), clone 2C3