PCDH20 polyclonal antibody (A01)
  • PCDH20 polyclonal antibody (A01)

PCDH20 polyclonal antibody (A01)

Ref: AB-H00064881-A01
PCDH20 polyclonal antibody (A01)

Información del producto

PCDH20 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name PCDH20
Gene Alias FLJ22218|PCDH13
Gene Description protocadherin 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RPPEIVPRYIANEIDGVVYLKELEPVNTPIAFFTIRDPEGKYKVNCYLDGEGPFRLSPYKPYNNEYLLETTKPMDYELQQFYEVAVVAWNSEGFHVKRVI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDH20 (NP_073754, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64881

Enviar un mensaje


PCDH20 polyclonal antibody (A01)

PCDH20 polyclonal antibody (A01)