SLC13A3 monoclonal antibody (M02), clone 3A6
  • SLC13A3 monoclonal antibody (M02), clone 3A6

SLC13A3 monoclonal antibody (M02), clone 3A6

Ref: AB-H00064849-M02
SLC13A3 monoclonal antibody (M02), clone 3A6

Información del producto

SLC13A3 monoclonal antibody (M02), clone 3A6
Información adicional
Size 100 ug
Gene Name SLC13A3
Gene Alias NADC3|SDCT2
Gene Description solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC13A3 (NP_073740, 152 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64849
Clone Number 3A6
Iso type IgG2a Kappa

Enviar un mensaje


SLC13A3 monoclonal antibody (M02), clone 3A6

SLC13A3 monoclonal antibody (M02), clone 3A6