SLC13A3 polyclonal antibody (A01)
  • SLC13A3 polyclonal antibody (A01)

SLC13A3 polyclonal antibody (A01)

Ref: AB-H00064849-A01
SLC13A3 polyclonal antibody (A01)

Información del producto

SLC13A3 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name SLC13A3
Gene Alias NADC3|SDCT2
Gene Description solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC13A3 (NP_073740, 152 a.a. ~ 232 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64849

Enviar un mensaje


SLC13A3 polyclonal antibody (A01)

SLC13A3 polyclonal antibody (A01)