MARCH7 monoclonal antibody (M02), clone 4G3
  • MARCH7 monoclonal antibody (M02), clone 4G3

MARCH7 monoclonal antibody (M02), clone 4G3

Ref: AB-H00064844-M02
MARCH7 monoclonal antibody (M02), clone 4G3

Información del producto

MARCH7 monoclonal antibody (M02), clone 4G3
Información adicional
Size 100 ug
Gene Name MARCH7
Gene Alias AXO|AXOT|DKFZp586F1122|MARCH-VII|RNF177
Gene Description membrane-associated ring finger (C3HC4) 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MARCH7 (NP_073737, 66 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64844
Clone Number 4G3
Iso type IgG2b Kappa

Enviar un mensaje


MARCH7 monoclonal antibody (M02), clone 4G3

MARCH7 monoclonal antibody (M02), clone 4G3