ISL2 monoclonal antibody (M03), clone 1D9
  • ISL2 monoclonal antibody (M03), clone 1D9

ISL2 monoclonal antibody (M03), clone 1D9

Ref: AB-H00064843-M03
ISL2 monoclonal antibody (M03), clone 1D9

Información del producto

ISL2 monoclonal antibody (M03), clone 1D9
Información adicional
Size 100 ug
Gene Name ISL2
Gene Alias FLJ10160
Gene Description ISL LIM homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ISL2 (NP_665804.1, 261 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64843
Clone Number 1D9
Iso type IgG2b Kappa

Enviar un mensaje


ISL2 monoclonal antibody (M03), clone 1D9

ISL2 monoclonal antibody (M03), clone 1D9