GNPNAT1 polyclonal antibody (A01)
  • GNPNAT1 polyclonal antibody (A01)

GNPNAT1 polyclonal antibody (A01)

Ref: AB-H00064841-A01
GNPNAT1 polyclonal antibody (A01)

Información del producto

GNPNAT1 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name GNPNAT1
Gene Alias FLJ10607|GNPNAT|Gpnat1
Gene Description glucosamine-phosphate N-acetyltransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNPNAT1 (NP_932332, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64841

Enviar un mensaje


GNPNAT1 polyclonal antibody (A01)

GNPNAT1 polyclonal antibody (A01)