FLJ23588 purified MaxPab mouse polyclonal antibody (B01P)
  • FLJ23588 purified MaxPab mouse polyclonal antibody (B01P)

FLJ23588 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064800-B01P
FLJ23588 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

FLJ23588 purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name EFCAB6
Gene Alias DJBP|FLJ23588|HSCBCIP1|KIAA1672|dJ185D5.1
Gene Description EF-hand calcium binding domain 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNCCRTLRELEIQVGEKVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIHKDTAVDYNVFLKNLSINNDLNLRYCMGNQEVSLENQQAKNSKKERLLGSASSEDIWRNYSLDEIERNFCLQLSKSYEKVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKATTKINWKQFLTSFHEPQGLQVSSKGPLTKRNSINSRNESHKENIITKLFRHTEDHSAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FLJ23588 (AAH39315, 1 a.a. ~ 1349 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64800

Enviar un mensaje


FLJ23588 purified MaxPab mouse polyclonal antibody (B01P)

FLJ23588 purified MaxPab mouse polyclonal antibody (B01P)